PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK35760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 311aa    MW: 35255.3 Da    PI: 6.3724
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK35760.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.91.2e-50141391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrF Ptdeel+v+yL++k++g +++l + i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + +g+ 
  KFK35760.1  14 LPPGFRFFPTDEELMVQYLCRKAAGYDFSL-QLIAEIDLYKFDPWVLPNKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIST-EGQR 110
                 79***************************9.89***************8777899*********************************999988.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk Lvfy g+apkg+kt+W+mheyrl
  KFK35760.1 111 VGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-669162IPR003441NAC domain
PROSITE profilePS5100559.22514162IPR003441NAC domain
PfamPF023654.4E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGIQETDPLA QLSLPPGFRF FPTDEELMVQ YLCRKAAGYD FSLQLIAEID LYKFDPWVLP  60
NKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISTEGQR VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLI EPSRRNGSSK LDDWVLCRIY KKQSSAQKQV YDNVITSTRE  180
FSNNATSSTT SSSSHFEDVL DSLHRDIDNR NFQFSSNSNQ LSSIRPELTE QKTEFVGTSS  240
YDWATSIACN SEHNSSQELG MSHVVPNLEL NYGFLKTEEE FNNSNELVQK GYGVDSVGFG  300
YSGQVGGFGF M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-12311687174NAC domain-containing protein 19
3swm_B1e-12311687174NAC domain-containing protein 19
3swm_C1e-12311687174NAC domain-containing protein 19
3swm_D1e-12311687174NAC domain-containing protein 19
3swp_A1e-12311687174NAC domain-containing protein 19
3swp_B1e-12311687174NAC domain-containing protein 19
3swp_C1e-12311687174NAC domain-containing protein 19
3swp_D1e-12311687174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00012PBMTransfer from AT1G52890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK35760.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by jasmonic acid. Not induced by cold treatment. {ECO:0000269|PubMed:12646039, ECO:0000269|PubMed:15319476}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0652680.0AY065268.1 Arabidopsis thaliana putative NAM protein (At1g52890) mRNA, complete cds.
GenBankAY1172240.0AY117224.1 Arabidopsis thaliana putative NAM protein (At1g52890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002894409.10.0NAC domain-containing protein 19
SwissprotQ9C9320.0NAC19_ARATH; NAC domain-containing protein 19
TrEMBLA0A087H0V80.0A0A087H0V8_ARAAL; Uncharacterized protein
STRINGA0A087H0V80.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52890.11e-173NAC domain containing protein 19
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Zheng XY, et al.
    Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation.
    Cell Host Microbe, 2012. 11(6): p. 587-96
    [PMID:22704619]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Guan Q,Yue X,Zeng H,Zhu J
    The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 438-53
    [PMID:24415771]
  5. Chen F, et al.
    Arabidopsis Phytochrome A Directly Targets Numerous Promoters for Individualized Modulation of Genes in a Wide Range of Pathways.
    Plant Cell, 2014. 26(5): p. 1949-1966
    [PMID:24794133]
  6. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  7. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  8. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  9. Gimenez-Ibanez S, et al.
    JAZ2 controls stomata dynamics during bacterial invasion.
    New Phytol., 2017. 213(3): p. 1378-1392
    [PMID:28005270]
  10. Ueda M, et al.
    The Distinct Roles of Class I and II RPD3-Like Histone Deacetylases in Salinity Stress Response.
    Plant Physiol., 2017. 175(4): p. 1760-1773
    [PMID:29018096]
  11. Kang M, et al.
    The C-Domain of the NAC Transcription Factor ANAC019 Is Necessary for pH-Tuned DNA Binding through a Histidine Switch in the N-Domain.
    Cell Rep, 2018. 22(5): p. 1141-1150
    [PMID:29386103]
  12. Sukiran NL,Ma JC,Ma H,Su Z
    ANAC019 is required for recovery of reproductive development under drought stress in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 161-174
    [PMID:30604322]