PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK35743.1
Common NameSPL4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family SBP
Protein Properties Length: 181aa    MW: 20864.3 Da    PI: 10.2741
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK35743.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.66.4e-4257133278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 Cqv++C++dl+eak+yhrrhkvCevh+ka+ v++sg++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk+++
  KFK35743.1  57 CQVDRCTSDLKEAKQYHRRHKVCEVHAKASYVFLSGINQRFCQQCSRFHELLEFDEAKRSCRRRLAGHNERRRKSSS 133
                 **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.6E-3350118IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.07754131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-3856135IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3157130IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MEGKRTTQGQ GYMKNKASVS YLVEEEMEND IDGEEEEKRN RVNKGYSGNT GGSSRLCQVD  60
RCTSDLKEAK QYHRRHKVCE VHAKASYVFL SGINQRFCQQ CSRFHELLEF DEAKRSCRRR  120
LAGHNERRRK SSSESFGEGS SSGRRGIIGQ VIQNQERSRM IRVRSVTNPK AQETNRKPRS  180
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-4745130184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8159511e-173KC815951.1 Arabis alpina SQUAMOSA promoter binding protein-like protein 4 (SPL4) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646322.12e-92PREDICTED: squamosa promoter-binding-like protein 4 isoform X1
RefseqXP_013752440.12e-92PREDICTED: squamosa promoter-binding-like protein 4 isoform X1
SwissprotQ9S7A91e-68SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLS4WUK11e-131S4WUK1_ARAAL; SQUAM
STRINGfgenesh2_kg.1__4389__AT1G53160.22e-80(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-56squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Bergonzi S, et al.
    Mechanisms of age-dependent response to winter temperature in perennial flowering of Arabis alpina.
    Science, 2013. 340(6136): p. 1094-7
    [PMID:23723236]