PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK35527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 312aa    MW: 36284.6 Da    PI: 5.781
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK35527.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.15.5e-5661331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtdeelv +yL++kv+++++el e+i+e+d+yk+ePwdLp k  + +++ ewyf+s+rdkky++g+r+nrat++gyWkatgkd++v s k+
  KFK35527.1   6 LPPGFRFHPTDEELVAYYLNRKVNDQTIEL-EIIPEIDLYKCEPWDLPeKsFLPGNDMEWYFYSTRDKKYPNGSRTNRATRAGYWKATGKDRTVES-KK 102
                 79****************************.99**************95334455788*************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++g+kktLv+ykgrap+g++t+Wvmheyrl
  KFK35527.1 103 VKMGMKKTLVYYKGRAPHGHRTNWVMHEYRL 133
                 99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-623154IPR003441NAC domain
PROSITE profilePS5100559.2796154IPR003441NAC domain
PfamPF023651.4E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLNRKVND QTIELEIIPE IDLYKCEPWD LPEKSFLPGN  60
DMEWYFYSTR DKKYPNGSRT NRATRAGYWK ATGKDRTVES KKVKMGMKKT LVYYKGRAPH  120
GHRTNWVMHE YRLIHHPSSS SFKESYALCR VFKKNIQIPK RKEEGDQEEE ISTSVGKEEE  180
QEEEEKKKKW RKCERESEED MESLKIASAE TSSSEGILLD EANSSSIFAL NFSSSLLDDH  240
LFSNYVPHHH ELPYHPPPLQ LQDFPQLSMS DAEIMSMDHI SKQQDFQCRD SMNGTLDEIF  300
SFSSSANFPA SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-55115412165NO APICAL MERISTEM PROTEIN
1ut4_B2e-55115412165NO APICAL MERISTEM PROTEIN
1ut7_A2e-55115412165NO APICAL MERISTEM PROTEIN
1ut7_B2e-55115412165NO APICAL MERISTEM PROTEIN
3swm_A2e-55115415168NAC domain-containing protein 19
3swm_B2e-55115415168NAC domain-containing protein 19
3swm_C2e-55115415168NAC domain-containing protein 19
3swm_D2e-55115415168NAC domain-containing protein 19
3swp_A2e-55115415168NAC domain-containing protein 19
3swp_B2e-55115415168NAC domain-containing protein 19
3swp_C2e-55115415168NAC domain-containing protein 19
3swp_D2e-55115415168NAC domain-containing protein 19
4dul_A2e-55115412165NAC domain-containing protein 19
4dul_B2e-55115412165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK35527.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006392555.11e-166NAC domain-containing protein 86
RefseqXP_010462486.11e-166PREDICTED: NAC domain-containing protein 86-like
SwissprotQ9FFI52e-80NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A087H0750.0A0A087H075_ARAAL; Uncharacterized protein
STRINGA0A087H0750.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81232640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-121NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]