PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK35377.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 335aa    MW: 38249.9 Da    PI: 6.4199
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK35377.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.7e-51111391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPt+eel+++yL+kk+++ k++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat+ g+Wkatg+dk ++s +
  KFK35377.1  11 VPPGFRFHPTEEELLQYYLRKKISNIKIDL-DVIRDVDLNKLEPWDIQEmcKIGTtPQNDWYFFSHKDKKYPTGTRTNRATTVGFWKATGRDKIIYS-N 107
                 69****************************.9***************962433332455**************************************.9 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 g  +g++ktLvfykgrap+g+k+dW+mheyrl
  KFK35377.1 108 GDRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                 999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-578174IPR003441NAC domain
PROSITE profilePS5100555.311174IPR003441NAC domain
PfamPF023651.2E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MNISVNGQSQ VPPGFRFHPT EEELLQYYLR KKISNIKIDL DVIRDVDLNK LEPWDIQEMC  60
KIGTTPQNDW YFFSHKDKKY PTGTRTNRAT TVGFWKATGR DKIIYSNGDR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD ENVLTSSSNH DDNETCEVIG GGDEGWVICR VFMKKSLCKA  180
IISSPGRSVK TSSFNEETIE QLLEAMGQSC KEEISLDPVL KLPNLECHDN TVTSYQRFMN  240
DNQVNGRHVR NIVDPSFATS WAALDRLVAS QLNGPNSYSI TAVDEITQSP YHGLNRTCYY  300
NTGLTPDYYT PEMEIWNDTM MPSSNSLCHV SNGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-48817614167NO APICAL MERISTEM PROTEIN
1ut4_B7e-48817614167NO APICAL MERISTEM PROTEIN
1ut7_A7e-48817614167NO APICAL MERISTEM PROTEIN
1ut7_B7e-48817614167NO APICAL MERISTEM PROTEIN
3swm_A8e-48817617170NAC domain-containing protein 19
3swm_B8e-48817617170NAC domain-containing protein 19
3swm_C8e-48817617170NAC domain-containing protein 19
3swm_D8e-48817617170NAC domain-containing protein 19
3swp_A8e-48817617170NAC domain-containing protein 19
3swp_B8e-48817617170NAC domain-containing protein 19
3swp_C8e-48817617170NAC domain-containing protein 19
3swp_D8e-48817617170NAC domain-containing protein 19
4dul_A7e-48817614167NAC domain-containing protein 19
4dul_B7e-48817614167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues such as tracheary elements. {ECO:0000269|PubMed:16214898}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00015PBMTransfer from AT3G61910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK35377.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104354.10.0PREDICTED: NAC domain-containing protein 66-like
SwissprotQ9M2740.0NAC66_ARATH; NAC domain-containing protein 66
TrEMBLA0A087GZS50.0A0A087GZS5_ARAAL; Uncharacterized protein
STRINGA0A087GZS50.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61910.10.0NAC domain protein 66
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]