PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK34090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family LBD
Protein Properties Length: 326aa    MW: 36833.9 Da    PI: 4.5537
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK34090.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260118.63.6e-37101091100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e ++++am+s+++++ +r r Pv+G++gv ++lq  +  +++el+++++
  KFK34090.1  10 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILEKLDEAQKPEAMKSIIFQSYVRDRSPVHGCLGVTQNLQYLIWLAEEELKAVNA 108
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 +
  KFK34090.1 109 Q 109
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6529110IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-3410107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MTLKGGTSGA CAACKYQRRR CAADCPLAPY FPAEQPKLFQ NVHRLFGVRS IVKILEKLDE  60
AQKPEAMKSI IFQSYVRDRS PVHGCLGVTQ NLQYLIWLAE EELKAVNAQL QLYRSQQNNG  120
QNQMMIQELG EKQEDVTSQL DLGMRLTINN NQSNVTPFFS PLQVSETQQQ QQQQMSYTYS  180
CSEVNNNGFS PPDYTDSCKE ILTNNNNNNN NTAVVWGQNR FAYTNNGFSN QNESIDEIKS  240
NNGVMAIQSQ LVNLQMVSNQ QEEDNAHEYD EIHQFLEIIE ERQSFGDSKE AYASSSGVSL  300
MKEPMDQIGE NELRTAATCF SLTSVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292170.11e-179hypothetical protein CARUB_v10018376mg
SwissprotQ9STS61e-142LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A087GW380.0A0A087GW38_ARAAL; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_50012751e-176(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-136LOB domain-containing protein 27