PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK33967.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 187aa    MW: 21505.9 Da    PI: 8.3088
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK33967.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.3e-17243548
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
       KFK33967.1  2 TPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 43
                     9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.772147IPR017930Myb domain
SMARTSM007173.1E-12145IPR001005SANT/Myb domain
CDDcd001676.66E-13143No hitNo description
SuperFamilySSF466895.46E-13247IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-20244IPR009057Homeodomain-like
PfamPF002494.1E-15242IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MTPQEERLVL ELHAKWGNRW SKIARKLPGR TDNEIKNYWR THMRKKAQEK KRPASPSSSF  60
SNCCSSSMTT TNTQDVSFQS RKTSGKVSFY DTGGSSREMN QETKDGYSMD DIWREIDHSE  120
VNMIKPVKDI YSEQSYCLSY PTLASPSLES SLDSIWNMDA DNSKMSSFGS YEFPFCFQHS  180
RSPWSSG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK33967.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149987.11e-105PREDICTED: transcription factor MYB48 isoform X2
SwissprotQ9LX823e-98MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A087GVR51e-137A0A087GVR5_ARAAL; Uncharacterized protein
STRINGA0A087GVR51e-138(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.21e-98myb domain protein 48
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nishida S,Kakei Y,Shimada Y,Fujiwara T
    Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana.
    Plant J., 2017. 91(4): p. 741-753
    [PMID:28586097]
  4. Imran QM, et al.
    Transcriptome profile of NO-induced Arabidopsis transcription factor genes suggests their putative regulatory role in multiple biological processes.
    Sci Rep, 2018. 8(1): p. 771
    [PMID:29335449]