PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK33878.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 244aa    MW: 27535.1 Da    PI: 6.0641
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK33878.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM128.55e-4061371128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                 lp+GfrF Pt+ el+++yL+ ++ g + ++++ i+ +d+++veP +Lp+     ++++ ++w fF++r++++a+g r++r+t sgyWkatg+  +v+s 
  KFK33878.1   6 LPVGFRFYPTEVELLSFYLRIQLGGGNATIHSLIPILDVFSVEPTQLPNlageWCRGDAEQWIFFVPRQEREARGGRPSRTTGSGYWKATGSPGPVFSP 104
                 79****************************999***************646654455788*************************************** PP

         NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                 +++++g+kkt+vfy+g+ap+g+kt+W m+ey++
  KFK33878.1 105 ENRVIGVKKTMVFYTGKAPTGRKTKWKMNEYKA 137
                 *******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-443162IPR003441NAC domain
PROSITE profilePS5100546.4236162IPR003441NAC domain
PfamPF023651.9E-197136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MEEQELPVGF RFYPTEVELL SFYLRIQLGG GNATIHSLIP ILDVFSVEPT QLPNLAGEWC  60
RGDAEQWIFF VPRQEREARG GRPSRTTGSG YWKATGSPGP VFSPENRVIG VKKTMVFYTG  120
KAPTGRKTKW KMNEYKAVDE AASVSTIPKL RNEFSLCRIY IKSGSSRAFD RRPMEAYGIE  180
RKLPIDRVET SFPATISTSP ETPYYSSGDQ VDLPVVNATT TQSNSEMVDG LSQPFWDWEQ  240
LNWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-34116712170NO APICAL MERISTEM PROTEIN
1ut4_B6e-34116712170NO APICAL MERISTEM PROTEIN
1ut7_A6e-34116712170NO APICAL MERISTEM PROTEIN
1ut7_B6e-34116712170NO APICAL MERISTEM PROTEIN
4dul_A6e-34116712170NAC domain-containing protein 19
4dul_B6e-34116712170NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK33878.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1386417e-96AL138641.2 Arabidopsis thaliana DNA chromosome 3, BAC clone T22K7.
GenBankCP0026867e-96CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001118771.11e-148NAC domain containing protein 61
SwissprotQ9M2901e-136NAC61_ARATH; Putative NAC domain-containing protein 61
TrEMBLA0A087GVH61e-180A0A087GVH6_ARAAL; Uncharacterized protein
STRINGA0A087GVH60.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.21e-140NAC domain containing protein 61