PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK33442.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 401aa    MW: 45764.4 Da    PI: 6.6063
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK33442.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.2e-51431682128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                 +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++++ +
  KFK33442.1  43 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSETSRPI 140
                 79***************************.89***************888889********************************************** PP

         NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                 glkktLvfy+g+apkg++t+W+m+eyrl
  KFK33442.1 141 GLKKTLVFYSGKAPKGTRTSWIMNEYRL 168
                 **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.27242189IPR003441NAC domain
SuperFamilySSF1019411.1E-5642189IPR003441NAC domain
PfamPF023652.8E-2544168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MSNQVNNNNN NEKGIEEDDN RGGHESQVPN DDEADDHDHD MVMPGFRFHP TEEELIEFYL  60
RRKVEGKRFN VELITFLDLY RYDPWELPAM AAIGEKEWYF YVPRDRKYRN GDRPNRVTTS  120
GYWKATGADR MIRSETSRPI GLKKTLVFYS GKAPKGTRTS WIMNEYRLPH HETEKYQKAE  180
ISLCRVYKRP GVEDHPSLPR SLSTRHHNHN SSSSSSRMAL RQQQQHHSST STHADNKLNN  240
NNLEKLSAEY SGEGSTTTTT NSNSDVTIAL ANQNIYRPMP YGATNTPIIS ISNHQEDDET  300
AIVDDLQRLV NYQISDGGNI NHQYYQIAQQ FHNSQQQTAN ANALQLVAAA TTGAMLTPQT  360
QAALAMNMIP SGTIPHNALW DMWNPVIPDG NRDHYTNVPF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-57331898165NO APICAL MERISTEM PROTEIN
1ut4_B8e-57331898165NO APICAL MERISTEM PROTEIN
1ut7_A8e-57331898165NO APICAL MERISTEM PROTEIN
1ut7_B8e-57331898165NO APICAL MERISTEM PROTEIN
4dul_A8e-57331898165NAC domain-containing protein 19
4dul_B8e-57331898165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK33442.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0008740.0BT000874.1 Arabidopsis thaliana clone C104984 putative NAM (no apical meristem) protein (At2g02450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565284.30.0NAC domain containing protein 35
SwissprotQ9ZVP80.0NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A087GU900.0A0A087GU90_ARAAL; Uncharacterized protein
STRINGA0A087GU900.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54362750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.20.0NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]