PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK33315.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 298aa    MW: 33659.7 Da    PI: 6.9587
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK33315.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-163882147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E+e++v+a k++G   W++I +++g ++t+ q++s+ qk+
       KFK33315.1 38 REKWTESEHEKFVEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 82
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-153287IPR009057Homeodomain-like
PROSITE profilePS5129420.4253387IPR017930Myb domain
TIGRFAMsTIGR015571.4E-163685IPR006447Myb domain, plants
SMARTSM007171.0E-123785IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-93878IPR009057Homeodomain-like
PfamPF002491.2E-133881IPR001005SANT/Myb domain
CDDcd001679.16E-104083No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MHEHCESLCD IASDDLIISS RDAFYLKTRK PYTITKQREK WTESEHEKFV EALKLYGRAW  60
RRIEEHVGTK TAVQIRSHAQ KFFTKVARDY DVSSEKSIEI PPPRPKRKPM HPYPRKLVIP  120
DAKEMAYAEL TGAKLVPDED NRSPTSVLSA HGSDGLGSMG SNSPNSSSAD YQLSPYSDIT  180
EFSQGLELSS HTEESLSPEA ETKQSLKLFG KTFVVGDYNS STSSNDSEDV KKKVDLETQS  240
VRCSSSSSEN AESSERSAFS QLKSSVIEMK NMKGFMPYKK RIKVEENMDS VKMSYPLW
Functional Description ? help Back to Top
Source Description
UniProtPositive regulator for cold-responsive gene expression and cold tolerance. Part of a regulatory feedback loop that controls a subset of the circadian outputs and modulates the central oscillator. Negatively self-regulates its own expression. {ECO:0000269|PubMed:17587236, ECO:0000269|PubMed:23371945}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK33315.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Up-regulated transiently by light. {ECO:0000269|PubMed:17587236, ECO:0000269|PubMed:19805390}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195151e-154AY519515.1 Arabidopsis thaliana MYB transcription factor (At5g37260) mRNA, complete cds.
GenBankBT0109471e-154BT010947.1 Arabidopsis thaliana At5g37260 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018442666.11e-166PREDICTED: protein REVEILLE 2
SwissprotF4K5X61e-162RVE2_ARATH; Protein REVEILLE 2
TrEMBLA0A087GTW30.0A0A087GTW3_ARAAL; Uncharacterized protein
STRINGA0A087GTW30.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144321922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.11e-125MYB_related family protein
Publications ? help Back to Top
  1. Chaudhury A,Okada K,Raikhel NV,Shinozaki K,Sundaresan V V
    A weed reaches new heights down under
    Plant Cell, 1999. 11(10): p. 1817-26
    [PMID:10521514]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Jiang Z,Xu G,Jing Y,Tang W,Lin R
    Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12377
    [PMID:27506149]