PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK32292.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family LBD
Protein Properties Length: 229aa    MW: 25275.8 Da    PI: 4.8782
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK32292.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.78.5e-4351148198
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++
  KFK32292.1  51 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAGARMRDPVYGCAGAIYHLQRQVSELQAQLAKTQ 148
                 7*********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.250151IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4251148IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MLKMEINGGI SAATPTASAV VLPATPVASP SPKSSPPQPL SPPQPSVVLS PCAACKILRR  60
RCAEKCVLAP YFPPTDPAKF TIAHRVFGAS NIIKFLQELP ESQRTDAVNS MVYEAGARMR  120
DPVYGCAGAI YHLQRQVSEL QAQLAKTQVD LVSMQLQRSN LLELIYKMEQ PKLSAQEQGQ  180
QNMCFECSFE SSDDFISSPE EERNDLGFLE DNNNINNNSS ISWWDPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140905.11e-128PREDICTED: LOB domain-containing protein 11
SwissprotQ9SK081e-125LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A087GQZ01e-170A0A087GQZ0_ARAAL; Uncharacterized protein
STRINGBra035698.1-P1e-125(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-118LOB domain-containing protein 11