PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK31356.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NF-YB
Protein Properties Length: 191aa    MW: 20592.6 Da    PI: 6.8863
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK31356.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.73.6e-5826121297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+ege+
  KFK31356.1  26 REQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGER 121
                 89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.9E-5421134IPR009072Histone-fold
SuperFamilySSF471131.09E-4128158IPR009072Histone-fold
PfamPF008081.2E-283195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.4E-215977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.4E-217896No hitNo description
PRINTSPR006157.4E-2197115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGDSDRDSGG GQNGNNQNGQ SPLSPREQDR FLPIANVSRI MKKALPANAK ISKDAKETMQ  60
ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKVY LQRFREIEGE  120
RTGLGRPQTS GEAGEHHRDA GVSDGGGYYG GGGMQYHQHH QFLHQQNHMY GATGGGGGNG  180
GGGAASGRTR T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-4926116292Transcription factor HapC (Eurofung)
4g92_B8e-4926116292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAY0780260.0AY078026.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBankAB0256280.0AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7.
GenBankAF3857440.0AF385744.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013697087.11e-105PREDICTED: nuclear transcription factor Y subunit B-2-like
SwissprotQ9FGJ34e-87NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBLA0A087GNA41e-141A0A087GNA4_ARAAL; Nuclear transcription factor y subunit b-3
STRINGBra017473.1-P4e-95(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47640.13e-83nuclear factor Y, subunit B2