PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK31354.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NF-YB
Protein Properties Length: 224aa    MW: 24991 Da    PI: 6.5098
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK31354.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.26.6e-5545141197
       NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 vreqdrf+Pianv+rim+k+lPa+akis+d+ket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yreleg++
  KFK31354.1  45 VREQDRFMPIANVIRIMRKILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEGDR 141
                 69*********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.3E-5041142IPR009072Histone-fold
SuperFamilySSF471139.89E-3848154IPR009072Histone-fold
PfamPF008084.2E-2551115IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.0E-167997No hitNo description
PROSITE patternPS0068508298IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.0E-1698116No hitNo description
PRINTSPR006151.0E-16117135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MELGGFHGYH KLEITTPPGP DSSMRLTEFN QANKTANGGD EECTVREQDR FMPIANVIRI  60
MRKILPAHAK ISDDSKETIQ ECVSEYISFI TGEANERCQR EQRKTITAED VLWAMSKLGF  120
DDYIEPLTLY LHRYRELEGD RGVSCGGTGS VSMTSGMVVK RPNGTMAEYG AYGPVPGIHM  180
AQYHYRHQNG FVFNGNEPNS KMGGSSSAAN GARVELFPTQ QHKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-3944136193NF-YB
4awl_B2e-3944136294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-3944136294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAY1384610.0AY138461.1 Arabidopsis thaliana leafy cotyledon 1-like L1L protein mRNA, complete cds.
GenBankAB0256280.0AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010441425.11e-140PREDICTED: nuclear transcription factor Y subunit B-6 isoform X2
RefseqXP_010495008.11e-140PREDICTED: nuclear transcription factor Y subunit B-6-like isoform X3
SwissprotQ84W661e-139NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A087GNA21e-170A0A087GNA2_ARAAL; Uncharacterized protein
STRINGAT5G47670.11e-137(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM98962636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.11e-127nuclear factor Y, subunit B6