PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK31193.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 642aa    MW: 71761.2 Da    PI: 4.987
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK31193.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.32.7e-11547245
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     g W + Ed +l+ av ++G+++W +I++ +  ++++k cksrw+
       KFK31193.1  5 GVWKKREDAILKAAVMKYGTNQWVRISSLLA-RKSAKRCKSRWY 47
                     78*****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.455154IPR017930Myb domain
SuperFamilySSF466891.63E-15265IPR009057Homeodomain-like
SMARTSM007174.9E-12352IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-16668IPR009057Homeodomain-like
PfamPF139211.6E-12767No hitNo description
CDDcd001674.00E-10748No hitNo description
PROSITE profilePS500904.5775172IPR017877Myb-like domain
SMARTSM007175755189IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MVKGGVWKKR EDAILKAAVM KYGTNQWVRI SSLLARKSAK RCKSRWYERH DPSINKSDWT  60
REEDEKLLHI AKLFPGEIDP NTTVAKPLCP ESDPIDMDED EKDMLSEARA RLANTRVGRD  120
RKKKGIEYNA EIPFEKRAPS GSCDTADEDL PAAQVIEEHD GKRMADVEAQ LNEQDAPAAT  180
LQANRLNDPD NELEEMAKMV YASDLLAEDE VLTGGCAATT PALLGNNSQT PMQVMTPMRT  240
PQSLSVGKAD AIMTEAENQT CLLGGENPEL HSSGFSGVTP RKKEIQMPNP GLNPLRAPSG  300
SCDTADEDRP ADQVTEELDG KRMADVEAQL RKQDVAGNKQ DASAAIMTEA EQDVAATLQA  360
NKLNDPEACR KGSELMLPPP SQISDEVLED TAKNGENEVV KGRCAADKGR PAWTDAKHDE  420
LMSLWRSGKD IDEVSKRFGI SVDSCGVRLR NLGCELKEIE VLVTNEERVF CVQILWPMEK  480
LNPKFLQKID QIRVEDKVDI EISPCMLDEY FSLISISASE EYNSISRVSA SCLKILLTCI  540
QKLGNHKFKR IIAGDCRVQL FTRGLRNFHT SFIIFYDRGY YAKGYVVKTN TYTGLNASVT  600
YDNDRYLIEI KGGWSSVRNA FEEAIRVLKK NFFTRVTYVN KE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5mqf_L2e-5813035421Cell division cycle 5-like protein
5xjc_L2e-5813035421Cell division cycle 5-like protein
5yzg_L2e-5813035421Cell division cycle 5-like protein
5z56_L2e-5813035421Cell division cycle 5-like protein
5z57_L2e-5813035421Cell division cycle 5-like protein
5z58_L2e-5813035421Cell division cycle 5-like protein
6ff4_L2e-5813035421Cell division cycle 5-like protein
6ff7_L2e-5813035421Cell division cycle 5-like protein
6icz_L2e-5813035421Cell division cycle 5-like protein
6id0_L2e-5813035421Cell division cycle 5-like protein
6id1_L2e-5813035421Cell division cycle 5-like protein
6qdv_O2e-5813035421Cell division cycle 5-like protein
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK31193.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019094643.11e-119PREDICTED: cell division cycle 5-like protein isoform X1
RefseqXP_023644690.11e-119cell division cycle 5-like protein
TrEMBLA0A087GMU10.0A0A087GMU1_ARAAL; Uncharacterized protein
STRINGA0A087GMU10.0(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.11e-121cell division cycle 5