PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30709.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 800aa    MW: 89400.4 Da    PI: 8.6671
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30709.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.8e-14549593147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
       KFK30709.1 549 RENWTEQEHDKFLEALHLFDRD-WKKIEAFVG-SKTVVQIRSHAQKY 593
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF578503.53E-14867No hitNo description
Gene3DG3DSA:3.30.40.103.1E-121071IPR013083Zinc finger, RING/FYVE/PHD-type
PfamPF136392.0E-81260IPR001841Zinc finger, RING-type
PROSITE profilePS5008912.8431260IPR001841Zinc finger, RING-type
CDDcd001629.96E-121263No hitNo description
SMARTSM001841.6E-51259IPR001841Zinc finger, RING-type
SuperFamilySSF466893.44E-16543599IPR009057Homeodomain-like
PROSITE profilePS5129415.6544598IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-6546599IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-17547596IPR006447Myb domain, plants
SMARTSM007171.3E-11548596IPR001005SANT/Myb domain
PfamPF002497.3E-12549593IPR001005SANT/Myb domain
CDDcd001672.29E-8551594No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MTEENAAANA ICSICYEDLK PVAENLQSIS ACGHVFHELC LQQWFEYCPA TNKRNCPICK  60
QKCSLKDPFR LYFQSSENQI DSKKSDDKIE EEDPVLLRNE VNRLEGKIHN LTLALENQKK  120
VNVDISDKLN QCKEQIKEDK VKKWEAMQEI LAAQNLLKAK SEECVQLNFR CGELHERTMA  180
LAKELASLKL VSDISLDEDD VRKLALLGNN ANTKDTIDTL VKSLVSRNKS YKELLAKCNQ  240
LGRGEALSSE RLEKALEKID KLKKQVREFE LITEERENKA LRDLKFSKNY SGREVSQPGN  300
ESVASFRMFP SDNTVEKIST PPLGRFDIRH SDSNTKDQKG EDTNVQEKHC NPMMKDMKFN  360
ISNNDPISSV SPRINGAGGI SFLSGLNQNL GRWNKQGDRN LATPTLGGSV SGKDDLIAFG  420
PDGKGGRIKI LRSNPQLSNV NASSGSGKRV KFGTKTNGSS SQENRLGYIT KNANANSETR  480
FLELLSMVSV NPRPTQGFPF LDPVNMSFNS PTPNSDGFRL TPIAPVTTVS FSEDSTMKIR  540
KPYTIKKSRE NWTEQEHDKF LEALHLFDRD WKKIEAFVGS KTVVQIRSHA QKYFLKVQKS  600
GTNEHLPPPR PKRKASHPYP QKAPKNVALT SHVVGSLPAS NVPSLIEPGY LYNADSQSLL  660
GNPAVCVSSS SSWSHESANP PIPLIEEEPG VSATALPKNL CYSTSSKEDT RRLLGVTKPK  720
DEDSCDKPPR VMPNFAEVYS FIGSVFDPNT TGHLQRLKEM DPINMETVLL LMRNLSLNLT  780
SPEFAEQRKL ISSYSAKTLK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1259264DKLKKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK30709.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006396284.10.0E3 ubiquitin-protein ligase TRAIP
TrEMBLA0A087GLF70.0A0A087GLF7_ARAAL; Uncharacterized protein
STRINGA0A087GLF70.0(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.11e-148MYB_related family protein