PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK29678.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 458aa    MW: 50159.1 Da    PI: 6.84
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK29678.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.53.6e-25160216259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +DgynWrKYGqK+vk+ + +rsYYrCt+ +C++kk +e+s++ ++v+ei+++g+H he
  KFK29678.1 160 RDGYNWRKYGQKQVKSPKGSRSYYRCTYFECCAKK-IECSNDSGNVIEIVNKGSHIHE 216
                 6********************************98.*********************8 PP

2WRKY99.81.7e-31324380359
                 -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++++v+itY+g Hnh+
  KFK29678.1 324 DGYRWRKYGQKMVKGNPYPRNYYRCTSAGCPVRKHIETALENTTAVIITYKGVHNHD 380
                 9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182903.66E-19155216IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.8E-19156217IPR003657WRKY domain
SMARTSM007741.5E-23159217IPR003657WRKY domain
PROSITE profilePS5081114.332161218IPR003657WRKY domain
PfamPF031068.1E-17161215IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.8E-32307382IPR003657WRKY domain
PROSITE profilePS5081132.156317382IPR003657WRKY domain
SuperFamilySSF1182902.35E-27318382IPR003657WRKY domain
SMARTSM007749.7E-36322381IPR003657WRKY domain
PfamPF031068.3E-24324380IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MESDKDEIKN TPEKVESGDG LSQLESLETT DANLEDLHDE PVRETLANDQ VKGVRQNSDV  60
EPNGEDVGGE VKLTDSGKEI IVRAIVPVDE VRVENRVAET SPGLTASSDP STVEPSLFST  120
PLAGEGLSVV SVPTKQEQRS DSRVVNNLSS PPVLRTPPPR DGYNWRKYGQ KQVKSPKGSR  180
SYYRCTYFEC CAKKIECSND SGNVIEIVNK GSHIHEPLRK NSFSPREIRP VSAIPPVSEG  240
NTVVEELAIV PSGSDLSALA KENICQSLTI VERKRHCETV AAEEPEAKRR LKKDNSESSD  300
SVSKHGKKNK FVVHAAGDVG ISGDGYRWRK YGQKMVKGNP YPRNYYRCTS AGCPVRKHIE  360
TALENTTAVI ITYKGVHNHD MPVPKKRHGP PSSMLVAAAA PTSMRTKSDD QFNTPTSSQC  420
SVGRESEKQS NEALDVGGEK VMESARTLLS IGFEIKQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-26309382174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567862.30.0WRKY DNA-binding protein 32
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A087GIH60.0A0A087GIH6_ARAAL; Uncharacterized protein
STRINGAT4G30935.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32