PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK29255.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 294aa    MW: 32733.5 Da    PI: 8.7297
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK29255.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.36.2e-53141391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrF Ptdeel+v+yL++kv+g++++l +vi ++d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g+ 
  KFK29255.1  14 LPPGFRFYPTDEELLVQYLCRKVAGHHFSL-QVIGDIDLYKFDPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITA-DGHR 110
                 79***************************9.99***************8777899*************************************99.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk Lvfy g+apkg+kt+W+mheyrl
  KFK29255.1 111 VGIKKALVFYAGKAPKGSKTNWIMHEYRL 139
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-679162IPR003441NAC domain
PROSITE profilePS5100560.93514162IPR003441NAC domain
PfamPF023652.2E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGIRERDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGHH FSLQVIGDID LYKFDPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITADGHR VGIKKALVFY  120
AGKAPKGSKT NWIMHEYRLI EHSRSHGSSK LDDWVLCRIY KKTSGSQRQA VQACREEHST  180
NGSSSSSSSQ LDDVLDSFPE IADRSFNLPR MNSLRTLLNS NFDWASLAGL NPIPELAPTN  240
GGYDAFRAAE GEAESGLSVD QQQNSGGLTQ SFGYSSNGLN RGFGVSGQTF GFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-10611687174NAC domain-containing protein 19
3swm_B1e-10611687174NAC domain-containing protein 19
3swm_C1e-10611687174NAC domain-containing protein 19
3swm_D1e-10611687174NAC domain-containing protein 19
3swp_A1e-10611687174NAC domain-containing protein 19
3swp_B1e-10611687174NAC domain-containing protein 19
3swp_C1e-10611687174NAC domain-containing protein 19
3swp_D1e-10611687174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK29255.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by cold treatment. Not induced by jasmonic acid. {ECO:0000269|PubMed:15319476, ECO:0000269|Ref.7}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3525350.0AK352535.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-04-F07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567773.10.0NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
SwissprotQ93VY30.0NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A087GHA30.0A0A087GHA3_ARAAL; Uncharacterized protein
STRINGA0A087GHA30.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.20.0NAC family protein
Publications ? help Back to Top
  1. Zhu X, et al.
    Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes.
    Plant J., 2015. 84(3): p. 597-610
    [PMID:26407000]
  2. Li S, et al.
    The role of ANAC072 in the regulation of chlorophyll degradation during age- and dark-induced leaf senescence.
    Plant Cell Rep., 2016. 35(8): p. 1729-41
    [PMID:27154758]
  3. Ye H, et al.
    RD26 mediates crosstalk between drought and brassinosteroid signalling pathways.
    Nat Commun, 2017. 8: p. 14573
    [PMID:28233777]