PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK28557.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family BES1
Protein Properties Length: 284aa    MW: 30779.5 Da    PI: 8.4027
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK28557.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822207.73.3e-6421351146
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                 ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +Gn+klpk++DnneVlkALc+eAGw+vedDGttyrkg+kp++++e ++ s+sasp+ss+q    
  KFK28557.1   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCTEAGWTVEDDGTTYRKGCKPMDRMELMNGSTSASPCSSYQ---- 96 
                 5899*******************************************************************************************.... PP

      DUF822 100 ssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                     +sp++sy++sp+sssf sp++    +  +a+sl+p+l++ls+ 
  KFK28557.1  97 ----PSPRASYNPSPSSSSFASPTN----PFGDANSLIPWLKNLSSN 135
                 ....*******************98....56677899****999763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.2E-593132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRIHGNF KLPKHCDNNE VLKALCTEAG  60
WTVEDDGTTY RKGCKPMDRM ELMNGSTSAS PCSSYQPSPR ASYNPSPSSS SFASPTNPFG  120
DANSLIPWLK NLSSNSPSKL PFFHGNSISA PVTPPLARSP TRDQVTIPDS GWLSGMQTPQ  180
SGPSSPTFSL VSRNPFFDNQ AFKMGDCNSP MWTPGQSGNC SPAIPAGLDQ TADVPMSDGM  240
AAEFAFGCNA IAAIGMVKPW EGERIHGECV SDDLELTLGN SRTR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00444DAPTransfer from AT4G18890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002870016.11e-178hypothetical protein ARALYDRAFT_492971
SwissprotO494041e-179BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLA0A087GFA50.0A0A087GFA5_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.7__2404__AT4G18890.11e-178(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-156BES1/BZR1 homolog 3