PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK28483.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 289aa    MW: 33384.1 Da    PI: 5.4485
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK28483.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.4e-5261351128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                 lppGfrFhPtdeel+ +yL +kveg ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rdkkya+g+r+nrat++gyWkatgkd+++++k +
  KFK28483.1   6 LPPGFRFHPTDEELIGYYLSRKVEGLEMEL-EVIPVIDLYKFDPWELPdKsFLPNRDMEWFFFCSRDKKYANGSRTNRATNAGYWKATGKDRKITCKsS 103
                 79***************************9.99**************96435556888**************************************855 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                   l+g +ktLvfy+grap g +t+W+mheyrl
  KFK28483.1 104 PGLIGYRKTLVFYQGRAPLGDRTNWFMHEYRL 135
                 667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-593159IPR003441NAC domain
PROSITE profilePS51005586159IPR003441NAC domain
PfamPF023651.3E-287135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGSSCLPPGF RFHPTDEELI GYYLSRKVEG LEMELEVIPV IDLYKFDPWE LPDKSFLPNR  60
DMEWFFFCSR DKKYANGSRT NRATNAGYWK ATGKDRKITC KSSPGLIGYR KTLVFYQGRA  120
PLGDRTNWFM HEYRLCDDDL SQKSPNFKGA FALCRVVKKN ELKTNSKTLK NKTEQELGSG  180
YSSLATSPCR DETTQFHSFK PYSTTNDASS IWISPDFILD SSKDYPQIQD VASEYFPNYH  240
FPVTSEDFRA SSSYLNVDQD IDQLVQTGYW TNYEYDQTGS FDFTQTFSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-49616017166NO APICAL MERISTEM PROTEIN
1ut4_B2e-49616017166NO APICAL MERISTEM PROTEIN
1ut7_A2e-49616017166NO APICAL MERISTEM PROTEIN
1ut7_B2e-49616017166NO APICAL MERISTEM PROTEIN
3swm_A3e-49616020169NAC domain-containing protein 19
3swm_B3e-49616020169NAC domain-containing protein 19
3swm_C3e-49616020169NAC domain-containing protein 19
3swm_D3e-49616020169NAC domain-containing protein 19
3swp_A3e-49616020169NAC domain-containing protein 19
3swp_B3e-49616020169NAC domain-containing protein 19
3swp_C3e-49616020169NAC domain-containing protein 19
3swp_D3e-49616020169NAC domain-containing protein 19
4dul_A2e-49616017166NAC domain-containing protein 19
4dul_B2e-49616017166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK28483.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0218894e-76AL021889.2 Arabidopsis thaliana DNA chromosome 4, BAC clone T6K21 (ESSA project).
GenBankAL1615474e-76AL161547.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 47.
GenBankCP0026874e-76CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020874762.10.0NAC domain-containing protein 86 isoform X2
SwissprotO496971e-155NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A087GF310.0A0A087GF31_ARAAL; Uncharacterized protein
STRINGA0A087GF310.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21512777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-152NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]