PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK28073.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 264aa    MW: 30290.2 Da    PI: 7.5303
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK28073.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.73.2e-5171311128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lp+GfrFhPtdeelv++yL+++++++++++  vi+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   ++
  KFK28073.1   7 LPAGFRFHPTDEELVKFYLCRRCASEPIHV-PVIAEIDLYKFNPWELPEMALYGEKEWYFFSHRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PKT 102
                 799***************************.89***************7666789*************************************98..778 PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  g+kk Lvfy g+apkg+kt+W+mheyrl
  KFK28073.1 103 LGIKKALVFYAGKAPKGVKTNWIMHEYRL 131
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-613159IPR003441NAC domain
PROSITE profilePS5100558.8287159IPR003441NAC domain
PfamPF023652.4E-268131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MKAELNLPAG FRFHPTDEEL VKFYLCRRCA SEPIHVPVIA EIDLYKFNPW ELPEMALYGE  60
KEWYFFSHRD RKYPNGSRPN RAAGTGYWKA TGADKPIGKP KTLGIKKALV FYAGKAPKGV  120
KTNWIMHEYR LANVDRSANT NKKNNLRLDD WVLCRIYNKK GTMEKYYPEP KTAMTSTSDS  180
KCSSHVISPD VTCSGSDHWE VQSEQKWVDN LDDAFDVSMF GSIDLLQNDA FVPQFPYNSD  240
FATPFQEDPH EQKPLSNWSF GPQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-82216510174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in regulation of seed germination under flooding. {ECO:0000269|PubMed:19176720}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK28073.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By low-oxygen stress. {ECO:0000269|PubMed:19176720}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0884310.0AY088431.1 Arabidopsis thaliana clone 6637 mRNA, complete sequence.
GenBankBT0008960.0BT000896.1 Arabidopsis thaliana clone C104908 unknown protein (At5g63790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394242.11e-175NAC domain-containing protein 102
SwissprotQ8H1151e-164NA102_ARATH; NAC domain-containing protein 102
TrEMBLA0A087GDX10.0A0A087GDX1_ARAAL; Uncharacterized protein
STRINGA0A087GDX10.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.11e-167NAC domain containing protein 102
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  4. Li B, et al.
    Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis.
    Plant Cell, 2018. 30(1): p. 178-195
    [PMID:29317470]