PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 336aa    MW: 38406.5 Da    PI: 8.4387
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27900.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.35.9e-57161421129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeel+++yL+kkv ++++++ ++i evd++k+ePw+Lp ++k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++l
  KFK27900.1  16 LPPGFRFHPTDEELITHYLHKKVLDTSFSA-KAIGEVDLNKSEPWELPWMAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR-GKSL 112
                 79***************************9.89***************8888899***************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                 vg+kktLvfy+grapkg+kt+Wvmheyrle
  KFK27900.1 113 VGMKKTLVFYRGRAPKGQKTNWVMHEYRLE 142
                 ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-6512166IPR003441NAC domain
PROSITE profilePS5100560.21516166IPR003441NAC domain
PfamPF023657.9E-3017141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
METFCGFQKE EEQMDLPPGF RFHPTDEELI THYLHKKVLD TSFSAKAIGE VDLNKSEPWE  60
LPWMAKMGEK EWYFFCVRDR KYPTGLRTNR ATEAGYWKAT GKDKEIYRGK SLVGMKKTLV  120
FYRGRAPKGQ KTNWVMHEYR LEGKFSPHNL PKTAKNEWVI CRVFQKSAGG KKIPISSLIR  180
IGSLGTDFNP SLLPSLTDSS PYIDKTKTEP VYVPCFSNQT DRAQGTTLNC FNSPVLNSIQ  240
TDIFQRIPLY QTQSLQASGN LQNPILAQEH SVLQAMIDNN RRQSLKTMSV SQETAVSTDM  300
NTDISSDFEL GKRRFDHQED PSSSAGPVDL ESFWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-551317217174NAC domain-containing protein 19
3swm_B2e-551317217174NAC domain-containing protein 19
3swm_C2e-551317217174NAC domain-containing protein 19
3swm_D2e-551317217174NAC domain-containing protein 19
3swp_A2e-551317217174NAC domain-containing protein 19
3swp_B2e-551317217174NAC domain-containing protein 19
3swp_C2e-551317217174NAC domain-containing protein 19
3swp_D2e-551317217174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK27900.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0546440.0AY054644.1 Arabidopsis thaliana NAM (no apical meristem)-like protein (MFB13.22) mRNA, complete cds.
GenBankAY0814960.0AY081496.1 Arabidopsis thaliana NAM (no apical meristem)-like protein (MFB13.22) mRNA, complete cds.
GenBankAY0851020.0AY085102.1 Arabidopsis thaliana clone 12970 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200951.10.0NAC domain containing protein 100
SwissprotQ9FLJ20.0NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A087GDE80.0A0A087GDE8_ARAAL; Uncharacterized protein
STRINGA0A087GDE80.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.10.0NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]