PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27822.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family CPP
Protein Properties Length: 498aa    MW: 55131.6 Da    PI: 7.6723
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27822.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.14.1e-14111149241
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                 ++k+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e
  KFK27822.1 111 KHKHCNCKNSRCLKLYCECFASGSYCNG-CNCLNCHNNLE 149
                 789*************************.********976 PP

2TCR51.71.7e-16195234140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 k++kgC+Ckks ClkkYCeC++a++ Cse+C+C+dCkN e
  KFK27822.1 195 KHSKGCHCKKSGCLKKYCECYQANVLCSENCRCQDCKNFE 234
                 589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-15110150IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.06111235IPR005172CRC domain
PfamPF036384.3E-11113147IPR005172CRC domain
SMARTSM011145.3E-19195236IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12198233IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MEKSDQELGS KRNLLPRQLD FSVTAAAATT TVEAMIDSFY ENGEKQSNSV IDSQSDLISP  60
PLGVKSVKPP PSSPATEVTT LQKPSIHRFS RVSKQDPLIS QVESKDGTSN KHKHCNCKNS  120
RCLKLYCECF ASGSYCNGCN CLNCHNNLEN ESSRQEAVTA ILERNPNAFK PKIAGSPHGM  180
NDLQEDVRQI LILGKHSKGC HCKKSGCLKK YCECYQANVL CSENCRCQDC KNFEGSEERN  240
VLLREPPVSE AYMQHAALNR AIDMSSYLKP HESKKRKSKE DSRSVAARGS SAVSHIVQNH  300
AGNHVIRNGD TSLFSIPNNR AVSGPTACTT YRSSLSNTIQ PHHVRELCSN LVLKAVDVAN  360
KMSGAKYEAN KKDPSLDPAQ RDAKEVNDSP DCVLNASRMD EKPLSPATRA LMCDEEHVIT  420
SEKETSARVK TSEEKEDADT SSEIYLEQER QILSSFRDYL IQLSTRGSIN GTNIKTNTNS  480
SRRKPEDEEQ SHRDSSLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-321032432131Protein lin-54 homolog
5fd3_B1e-321032432131Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267276LKPHESKKRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK27822.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1728831e-74AC172883.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH125N23, complete sequence.
GenBankAC1893211e-74AC189321.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB036J07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024006995.10.0protein tesmin/TSO1-like CXC 7
SwissprotF4JY840.0TCX7_ARATH; Protein tesmin/TSO1-like CXC 7
TrEMBLA0A087GD700.0A0A087GD70_ARAAL; Uncharacterized protein
STRINGA0A087GD700.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134631628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25790.10.0Tesmin/TSO1-like CXC domain-containing protein