PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27735.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 464aa    MW: 52301 Da    PI: 5.8083
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27735.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1609.5e-50131411128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lp+GfrF+Ptdeelv +yL+ k++g++ e+ +vi+evdi+k+ePwdLp  + vk++++ew fF++ d+ky++g+r nrat +gyWkatgkd++v+s ++
  KFK27735.1  13 LPVGFRFSPTDEELVRYYLRLKINGRDDEV-RVIREVDICKWEPWDLPdfSVVKTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKSGNT 110
                 79*************************999.99***************6447888999**************************************99* PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + +g+k+tLvfy+grapkg++t W++heyr+
  KFK27735.1 111 KIIGVKRTLVFYTGRAPKGTRTCWIIHEYRA 141
                 *****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-565164IPR003441NAC domain
PROSITE profilePS5100554.36313164IPR003441NAC domain
PfamPF023659.4E-2414140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MKDDMEVLSL ASLPVGFRFS PTDEELVRYY LRLKINGRDD EVRVIREVDI CKWEPWDLPD  60
FSVVKTTDSE WLFFCPLDRK YPSGSRMNRA TVAGYWKATG KDRKVKSGNT KIIGVKRTLV  120
FYTGRAPKGT RTCWIIHEYR ATEKDLDGTK SGQNPFVICK LFKKQDVVND AAAEDSKSCE  180
VEPAVSSPTV VDGMKSDVEL SEVSPGFPRT EDMRNSEIVD SSLAVSSECR SDISAPEVTN  240
TELDDIDWLS YPELESLNYK LFSPLHSQVQ SELGSSYNGF QSESSELFIN HNGAHIQTQY  300
GTNDDADEYM TKFLDSFLDV PYDLPEKKDI MQLAPEQIPY YPQNLINTSN KINNDVSDTG  360
IKIRARRTQA HGDQFVMQGD ASRRLRLQVH KSETDSPQIK KEVTDTARET LTKGFVNFIR  420
SKSKNGFLSK RIAAMGCSNR GLIRAGVVAV VFVMSVCSLS AVFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-45816512166NO APICAL MERISTEM PROTEIN
1ut4_B7e-45816512166NO APICAL MERISTEM PROTEIN
1ut7_A7e-45816512166NO APICAL MERISTEM PROTEIN
1ut7_B7e-45816512166NO APICAL MERISTEM PROTEIN
3swm_A9e-45816515169NAC domain-containing protein 19
3swm_B9e-45816515169NAC domain-containing protein 19
3swm_C9e-45816515169NAC domain-containing protein 19
3swm_D9e-45816515169NAC domain-containing protein 19
3swp_A9e-45816515169NAC domain-containing protein 19
3swp_B9e-45816515169NAC domain-containing protein 19
3swp_C9e-45816515169NAC domain-containing protein 19
3swp_D9e-45816515169NAC domain-containing protein 19
4dul_A7e-45816512166NAC domain-containing protein 19
4dul_B7e-45816512166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK27735.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010421284.10.0PREDICTED: NAC domain-containing protein 91-like isoform X1
RefseqXP_010421286.10.0PREDICTED: NAC domain-containing protein 91-like isoform X3
SwissprotQ9LKG80.0NAC91_ARATH; NAC domain-containing protein 91
TrEMBLA0A087GCY30.0A0A087GCY3_ARAAL; Uncharacterized protein
STRINGA0A087GCY30.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.20.0TCV-interacting protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ben Daniel BH, et al.
    Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.
    Physiol Plant, 2016. 157(4): p. 422-41
    [PMID:26923089]
  3. Li Y, et al.
    The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains.
    Virus Res., 2016. 222: p. 94-105
    [PMID:27288723]