PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27576.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family ARF
Protein Properties Length: 792aa    MW: 87927 Da    PI: 6.1501
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27576.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.82.5e-24173274199
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                 f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   +++++el+
  KFK27576.1 173 FCKTLTASDTSTHGGFSVPRRAAEDCfapldyK-QQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RDEDGELR 268
                 99****************************963.3445679************************************************..5699999* PP

                 EEEE-S CS
          B3  94 vkvfrk 99 
                 ++++r+
  KFK27576.1 269 LGIRRA 274
                 ***996 PP

2Auxin_resp117.41.2e-38300379382
  Auxin_resp   3 haastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 +a+stks+F+v+Y+Pra+++eFv+++ k+ ++ ++++s+G+Rf+m+fe+eds+err++G+v+gv dldp+rWpnSkWr+L
  KFK27576.1 300 NAVSTKSMFHVFYSPRATHAEFVIPYMKYITSNRNPISIGTRFRMRFEMEDSPERRCAGVVTGVCDLDPYRWPNSKWRCL 379
                 799****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.16E-43165281IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-40166287IPR015300DNA-binding pseudobarrel domain
CDDcd100172.23E-21171273No hitNo description
PfamPF023622.5E-22173274IPR003340B3 DNA binding domain
SMARTSM010192.1E-23173275IPR003340B3 DNA binding domain
PROSITE profilePS5086313.38173275IPR003340B3 DNA binding domain
PfamPF065071.4E-32300379IPR010525Auxin response factor
SuperFamilySSF542771.37E-10665747No hitNo description
PfamPF023093.4E-5665748IPR033389AUX/IAA domain
PROSITE profilePS5174520.453669751IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MEFDLNTEIA EVEEEENDDV RVRIEKGRLG ILPSSSSSCS SGSSSSSSST TTASVSSIYS  60
ELWHACAGPL TSLPKKGNVV VYFPQGHLEQ DAMVSYSSTL EIPKFELNPQ IFCRVVNVQL  120
LANKETDEVY TQVSLLPLQE FSMLNADGKE VRELGGDEER NGISTIKRTP HMFCKTLTAS  180
DTSTHGGFSV PRRAAEDCFA PLDYKQQRPS QELIAKDLHG VEWKFRHIYR GQPRRHLLTT  240
GWSIFVSQKN LVSGDAVLFL RDEDGELRLG IRRAARPRNG LPDSIIEKNS CSNILSLVGN  300
AVSTKSMFHV FYSPRATHAE FVIPYMKYIT SNRNPISIGT RFRMRFEMED SPERRCAGVV  360
TGVCDLDPYR WPNSKWRCLL VRWDESFVSD HQERVSPWEI DPSVSLPPLS IQSSPRPKRP  420
WAGLLDTTPT GNPITERGGF MDFEESVRPS KVLQGQENIG SASPLQGFDV MNRRILDFAM  480
QSHANPVLLS GRVKDRFGEF VDATALDPAC SGVMDLDRFP RVLQGQEICS LRSFPQMAGF  540
SPAPASGKPN LGYTDPFAYQ ANKSSFYPLA SQGIRSTHIP YQNQYNAGDK SSGLPSRAIN  600
FGGETGKFDA QNEGGLPKNV TADLPFKIGM TGKQKGADFN MNASSGCKLF GFSLPVETPT  660
SNPQSSSKRI CTKVHKQGSL VGRAIDLSRL NGYNDLLTEL ERLFNMEGLL RDPEKGWRIL  720
YTDSENDMMV VGDDPWHDFC NVVCKIHLYT KEEVENANDD NKSCLEQAAL MMEASKSSSV  780
TQPDSSPTVT TV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1146140222354Auxin response factor 1
4ldw_A1e-1146140222354Auxin response factor 1
4ldw_B1e-1146140222354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK27576.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808320.0AY080832.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
GenBankAY1139770.0AY113977.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400848.10.0auxin response factor 4 isoform X2
RefseqXP_020889184.10.0auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A087GCH40.0A0A087GCH4_ARAAL; Auxin response factor
STRINGA0A087GCH40.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]