PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 216aa    MW: 24647.7 Da    PI: 9.3729
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27514.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66.1e-184287148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
       KFK27514.1 42 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 87
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.646136IPR017877Myb-like domain
SuperFamilySSF466891.55E-222292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-102248IPR009057Homeodomain-like
PROSITE profilePS5129427.8143791IPR017930Myb domain
SMARTSM007172.2E-174189IPR001005SANT/Myb domain
PfamPF002492.2E-164286IPR001005SANT/Myb domain
CDDcd001676.69E-134487No hitNo description
Gene3DG3DSA:1.10.10.605.9E-214988IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGFCSQSFRF EGGGRNIRLG LNRTGKSCRL RWVNYLHPGL KRGKMTPQEE RLVLELHAKW  60
GNRWSKIARK LPGRTDNEIK NYWRTHMRKK AQEKKRPTSP TSSSSTSSLT TATTQDTGGS  120
NGKMIQECED GYYSMDDIWR EIDQSGANIV KPVRDIYYSE QSCYLNFPPL ASPALESSLE  180
SIWNMDADES KMSSFAIDQF PLSFEHGRSS WSSLAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-18239137105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK27514.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0752530.0DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010443757.11e-145PREDICTED: transcription factor MYB59 isoform X2
SwissprotQ4JL841e-122MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A087GCB21e-161A0A087GCB2_ARAAL; Uncharacterized protein
STRINGA0A087GCB21e-161(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.21e-110myb domain protein 59
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nishida S,Kakei Y,Shimada Y,Fujiwara T
    Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana.
    Plant J., 2017. 91(4): p. 741-753
    [PMID:28586097]
  4. Hickman R, et al.
    Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network.
    Plant Cell, 2017. 29(9): p. 2086-2105
    [PMID:28827376]