PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27418.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 288aa    MW: 31684.4 Da    PI: 6.7988
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27418.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-14141185347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
       KFK27418.1 141 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 185
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.9913186IPR017884SANT domain
SMARTSM007176.1E-83284IPR001005SANT/Myb domain
SuperFamilySSF466893.18E-103589IPR009057Homeodomain-like
CDDcd001671.86E-73581No hitNo description
PROSITE profilePS5129420.772134190IPR017930Myb domain
SuperFamilySSF466896.89E-17136189IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-17137189IPR006447Myb domain, plants
SMARTSM007173.2E-13138188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-12138185IPR009057Homeodomain-like
CDDcd001671.19E-11141186No hitNo description
PfamPF002495.0E-13141185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MEILRPTTTS HVTSGGNWLM EDTKSNVVVT GEGATWTAAE NKAFENALAV YDDNTPDRWQ  60
KVAAVIPGKT VSDVIKQYNE LEADVSSIEA GLIPVPGYVT SPFTLDWTGG GCNGFKPGHP  120
VGNKRSPSGR SPELERKKGV PWTEEEHKLF LMGLKKYGKG DWRNISRNFV ITRTPTQVAS  180
HAQKYFIRQL SGGKDKRRAS IHDITTVNLE DEVSLETNKS SIVMPEQRSR LTAFPWTQTD  240
NNNGTPGDAF NITIGNAITG VHSYGQALLG TYNNADSCYD AQNTMFQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1831101676RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00568DAPTransfer from AT5G58900Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK27418.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401027.10.0transcription factor DIVARICATA
SwissprotQ8S9H71e-104DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A087GC160.0A0A087GC16_ARAAL; Uncharacterized protein
STRINGA0A087GC160.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.10.0Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]