PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK26800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family TCP
Protein Properties Length: 299aa    MW: 32512.7 Da    PI: 6.7831
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK26800.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP116.43.7e-3668138373
         TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                 + k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti WLl+ ++ ai+e+tgt++++a ++
  KFK26800.1  68 APKRSTKDRHTKVEGRGRRIRMPATCAARVFQLTRELGHKSDGETIRWLLEHSESAIIEATGTGTIPAIAV 138
                 5699***********************************************************99999444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.8E-3072145IPR005333Transcription factor, TCP
PROSITE profilePS5136927.31973127IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MESSQEGKAI QEIDENVVLS NNDNSSLVVT MTRKTDPDPE TNPGMLMKQE VGFVQPITNS  60
LVLQTKPAPK RSTKDRHTKV EGRGRRIRMP ATCAARVFQL TRELGHKSDG ETIRWLLEHS  120
ESAIIEATGT GTIPAIAVSV NGTLKIPTTS PPQLVSDGGS GDLTRKPRKR KCSSEFVDVN  180
EHDCSVISGL APITPCNYGV NVMNLNTQNF MPFWPFGTNG LNQTGHMWAM PTVAATAPFL  240
NVGTRPVTSY VSNASDVAET QMETNGGEMR DFSLEIYDKK ELQFLGGSGN TSPSSCHKT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00007PBMTransfer from 495258Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK26800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401898.11e-148transcription factor TCP19
RefseqXP_024012296.11e-148transcription factor TCP19
SwissprotQ9LT891e-126TCP19_ARATH; Transcription factor TCP19
TrEMBLA0A087GA980.0A0A087GA98_ARAAL; Uncharacterized protein
STRINGA0A087GA980.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125832530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.21e-128TCP family protein