PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK26432.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family M-type_MADS
Protein Properties Length: 222aa    MW: 25596.7 Da    PI: 9.4711
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK26432.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.23.3e-161046238
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEE CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevavi 38
                +ie++s r+ tf kR+ gilKKAeEL +LCd+ +++ 
  KFK26432.1 10 FIESESARKSTFKKRKRGILKKAEELAILCDVPICMR 46
                8*********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.367147IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-20160IPR002100Transcription factor, MADS-box
CDDcd002661.71E-20285No hitNo description
SuperFamilySSF554552.62E-21295IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-8323IPR002100Transcription factor, MADS-box
PfamPF003195.3E-151045IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MTRQKLKLAF IESESARKST FKKRKRGILK KAEELAILCD VPICMRIDSP YDPNPEVWPS  60
EEKMSKIVSD WKMLSVMDKT KKMVNLETFL QQRITKEIES WRKLRKENRE REMKEVMFDC  120
IKGKTSVSQI AKTDLPDLAC VIDQCLKDLN HRIEVLNKNG ESSSSSAFVA STAATTPSNA  180
MSMVEMRSSS VEFYNKIREQ IEKSLNMETS IKDLDLNQKQ MG
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK26432.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010421522.17e-95PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A087G9801e-161A0A087G980_ARAAL; Uncharacterized protein
STRINGA0A087G9801e-161(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.12e-78M-type_MADS family protein