PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK25943.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 378aa    MW: 42504.4 Da    PI: 8.2125
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK25943.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27.1e-175195147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT eE++++v+a k++G   W++I +++g ++t+ q++s+ qk+
       KFK25943.1 51 RERWTDEEHKKFVEALKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 95
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1645100IPR009057Homeodomain-like
PROSITE profilePS5129420.27746100IPR017930Myb domain
TIGRFAMsTIGR015571.6E-164998IPR006447Myb domain, plants
SMARTSM007174.9E-135098IPR001005SANT/Myb domain
PfamPF002498.7E-145194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-95191IPR009057Homeodomain-like
CDDcd001671.76E-95396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MASANVQVTK APSRNRVEET EDKQIQFNEQ VSGENDYAPK VRKPYTITKE RERWTDEEHK  60
KFVEALKLYG RAWRRIEEHV GTKTAVQIRS HAQKFFSKVA REVTGGNGSS LEPIVIPPPR  120
PKRKPMHPYP RKFGNEADQT SRSVSPSERD NRSPTSVLST VGSEALGSSD SHSPNRSVSP  180
VSSASPPTAT TATAPEELES LKLELFPRER LLSRESLIKE PTKQSLKLFG KTVMVSDSDM  240
SSSLTTSTYC KSPIQPLPRK LSQAETFPIT INSQEELMSS WIQVPHKQDE VDSEKALQNE  300
GSSTGSNTGS VDDTGHTDKI SEAETMVCKW EFKPSERSAF SELRRRNSDS NSIGFGPYKK  360
RKMVIEQEEE EQEIRLYL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1343361RRRNSDSNSIGFGPYKKRK
Functional Description ? help Back to Top
Source Description
UniProtMorning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK25943.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531090.0AK353109.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-B24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400263.10.0protein REVEILLE 1
SwissprotF4KGY60.0RVE1_ARATH; Protein REVEILLE 1
TrEMBLA0A087G7U10.0A0A087G7U1_ARAAL; Uncharacterized protein
STRINGA0A087G7U10.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63562644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-162MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Xu G, et al.
    REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis.
    Photosyn. Res., 2015. 126(2-3): p. 331-40
    [PMID:25910753]
  3. Jiang Z,Xu G,Jing Y,Tang W,Lin R
    Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12377
    [PMID:27506149]