PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK25233.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 284aa    MW: 32270.2 Da    PI: 5.735
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK25233.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.15e-5171311128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lp+GfrFhPtdeelv++yL++k++++++++  vi+e+d+yk++Pw+Lp++   +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   ++
  KFK25233.1   7 LPAGFRFHPTDEELVKFYLCRKCASEPISA-PVIAEIDLYKFNPWELPEMSLYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PKT 102
                 799*************************99.89***************66566899************************************98..778 PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  g+kk Lvfy g+apkg kt+W+mheyrl
  KFK25233.1 103 LGIKKALVFYAGKAPKGIKTNWIMHEYRL 131
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-613159IPR003441NAC domain
PROSITE profilePS5100559.4057159IPR003441NAC domain
PfamPF023656.9E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008361Biological Processregulation of cell size
GO:0009416Biological Processresponse to light stimulus
GO:0009611Biological Processresponse to wounding
GO:0009620Biological Processresponse to fungus
GO:0009744Biological Processresponse to sucrose
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0043424Molecular Functionprotein histidine kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MKAELNLPAG FRFHPTDEEL VKFYLCRKCA SEPISAPVIA EIDLYKFNPW ELPEMSLYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGKP KTLGIKKALV FYAGKAPKGI  120
KTNWIMHEYR LANVDRSASV HKKNNLRLDD WVLCRIYNKK GTMEKYYPAD EKPRTTTMGD  180
QSSSPFDTSD STYPTLQEDD SSSSGGHGHV VSPDVREVQS EPKWGDLEDA LEDFDASMFG  240
GSMELLQNDG FVPQFLYQPT DFFTSFQDPP EQKPFLNWGF APQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-83216510174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in disease resistance response (PubMed:16115070, PubMed:19625399). May function as repressor of pathogenesis-related proteins (PubMed:16115070). May function in the regulation of host basal defense responses against viral infection (PubMed:19625399). Transcriptional activator involved in responses to wounding and infection with tobamovirus (TMV) (PubMed:22937923). Binds to the DNA sequences 5'-AAAATATCT-3' and 5'AGATTTTT-3' of CYP734A1/BAS1 and CYP72C1/SOB7 promoters, respectively. Acts as suppressor of the brassinosteroid (BR)-inactivating enzymes CYP734A1/BAS1 and CYP72C1/SOB7, and prevents their expression in almost all tissues. Plays a central role in integrating BR homeostasis and seedling development. Regulates the spatial regulation of BR homeostasis and participates in the regulation of hypocotyl elongation and root growth by suppressing BR catabolism. Mediates connection between BR catabolism and photomorphogenesis (PubMed:26493403). Binds to, and transactivates the promoter of the auxin biosynthetic gene NIT2 (PubMed:22965747). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:16115070, ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:19625399, ECO:0000269|PubMed:22937923, ECO:0000269|PubMed:22965747, ECO:0000269|PubMed:26493403, ECO:0000269|PubMed:26518251}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK25233.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding, salicylic acid (SA), methyl jasmonate, drought stress, dark and sucrose starvation (PubMed:16115070). Induced by chitin elicitor (chitooctaose) (PubMed:17722694). Induced by salicylic acid and infection with tobamovirus (TMV) (PubMed:19625399). By indole-3-acetonitrile, salicylic acid (SA), sodium nitroprusside (SNP), salt stress and drought stress (PubMed:22965747). Down-regulated by brassinosteroid (BR) and transition from dark to white light (PubMed:26493403). {ECO:0000269|PubMed:16115070, ECO:0000269|PubMed:17722694, ECO:0000269|PubMed:19625399, ECO:0000269|PubMed:22965747, ECO:0000269|PubMed:26493403}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_680161.10.0NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
SwissprotQ9C5980.0NAC81_ARATH; Protein ATAF2
TrEMBLA0A087G5T10.0A0A087G5T1_ARAAL; Uncharacterized protein
STRINGA0A087G5T10.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.10.0NAC family protein
Publications ? help Back to Top
  1. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]