PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK25187.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 287aa    MW: 32551.2 Da    PI: 5.0392
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK25187.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.22.9e-48141401128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 l pGfrF+Ptd el+++yL++k++g++ ++  vi+ev+iyk+ePwdLp ++  ++e+ew++F+ r +ky++g++++rat  gyWkatgk+++v+s +++
  KFK25187.1  14 LFPGFRFSPTDVELISYYLRRKIDGDEDSV-AVIAEVEIYKFEPWDLPgESKLKSENEWFYFCARGRKYPHGSQSRRATLLGYWKATGKERSVKS-GNQ 110
                 579************************999.89***************543334678**************************************.999 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  vg+k+tLvf+ grap+ge+t+W+mhey +
  KFK25187.1 111 IVGTKRTLVFHMGRAPRGERTEWIMHEYCI 140
                 ****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-537155IPR003441NAC domain
PROSITE profilePS5100552.31114156IPR003441NAC domain
PfamPF023655.5E-2416139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSKEAELSIA VSALFPGFRF SPTDVELISY YLRRKIDGDE DSVAVIAEVE IYKFEPWDLP  60
GESKLKSENE WFYFCARGRK YPHGSQSRRA TLLGYWKATG KERSVKSGNQ IVGTKRTLVF  120
HMGRAPRGER TEWIMHEYCI NGAPQDALVV CRLRKNADFR ASSSQRQMED GLVQDDDYVS  180
TSERDKKSYS VYEPELQISN GDITESSNVV EDQAETDDDC YAEILNDDII NLDGEALKAS  240
QTFRQNDPTQ QKTIVSEASS RSRTLQTLPR TGESPIRSAS KKMIARD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-431316616171NO APICAL MERISTEM PROTEIN
1ut4_B5e-431316616171NO APICAL MERISTEM PROTEIN
1ut7_A5e-431316616171NO APICAL MERISTEM PROTEIN
1ut7_B5e-431316616171NO APICAL MERISTEM PROTEIN
3swm_A6e-431316619174NAC domain-containing protein 19
3swm_B6e-431316619174NAC domain-containing protein 19
3swm_C6e-431316619174NAC domain-containing protein 19
3swm_D6e-431316619174NAC domain-containing protein 19
3swp_A6e-431316619174NAC domain-containing protein 19
3swp_B6e-431316619174NAC domain-containing protein 19
3swp_C6e-431316619174NAC domain-containing protein 19
3swp_D6e-431316619174NAC domain-containing protein 19
3ulx_A5e-43413810138Stress-induced transcription factor NAC1
4dul_A5e-431316616171NAC domain-containing protein 19
4dul_B5e-431316616171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK25187.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634548.11e-169PREDICTED: NAC domain-containing protein 40 isoform X1
RefseqXP_013690731.11e-169NAC domain-containing protein 40-like isoform X1
SwissprotQ9XIN71e-160NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A087G5N50.0A0A087G5N5_ARAAL; Uncharacterized protein
STRINGA0A087G5N50.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM104532533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.11e-163NTM1-like 8
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]