PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK25161.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 320aa    MW: 36884.7 Da    PI: 9.124
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK25161.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.45.4e-57171421128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeel+++yL+kkv + ++++ ++i +vd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++l
  KFK25161.1  17 LPPGFRFHPTDEELITHYLHKKVLDVEFSA-KAIGDVDLNKAEPWELPYKAKMGEKEWYFFCVRDRKYPTGLRTNRATQAGYWKATGKDKEIFR-GKSL 113
                 79**************************99.88***************99999*****************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kktLvfykgrapkg+kt+Wvmheyrl
  KFK25161.1 114 VGMKKTLVFYKGRAPKGQKTNWVMHEYRL 142
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6414167IPR003441NAC domain
PROSITE profilePS5100560.23317167IPR003441NAC domain
PfamPF023658.0E-3018142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
METFGGFHKE DDEHMDLPPG FRFHPTDEEL ITHYLHKKVL DVEFSAKAIG DVDLNKAEPW  60
ELPYKAKMGE KEWYFFCVRD RKYPTGLRTN RATQAGYWKA TGKDKEIFRG KSLVGMKKTL  120
VFYKGRAPKG QKTNWVMHEY RLDGKLSAQN LPKTAKNEWV ICRVFHKTAG GKKIPISTLI  180
RIGSYTTGSN LPHLTDSSPY INDKTKTEPI YVPCFSNQNE NRETILNYFS NNASLSSIQP  240
DFLQRIPLYQ PQSLNVSENQ ILTQEQSVLQ AMILENNRRQ SFKNTDVSSD FEFGRKRLDH  300
QEVPSSSSAG PVDVEPFWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-551417314171NO APICAL MERISTEM PROTEIN
1ut4_B1e-551417314171NO APICAL MERISTEM PROTEIN
1ut7_A1e-551417314171NO APICAL MERISTEM PROTEIN
1ut7_B1e-551417314171NO APICAL MERISTEM PROTEIN
3swm_A1e-551417317174NAC domain-containing protein 19
3swm_B1e-551417317174NAC domain-containing protein 19
3swm_C1e-551417317174NAC domain-containing protein 19
3swm_D1e-551417317174NAC domain-containing protein 19
3swp_A1e-551417317174NAC domain-containing protein 19
3swp_B1e-551417317174NAC domain-containing protein 19
3swp_C1e-551417317174NAC domain-containing protein 19
3swp_D1e-551417317174NAC domain-containing protein 19
4dul_A1e-551417314171NAC domain-containing protein 19
4dul_B1e-551417314171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00496DAPTransfer from AT5G07680Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK25161.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2280270.0AK228027.1 Arabidopsis thaliana mRNA for no apical meristem (NAM) -like protein, complete cds, clone: RAFL14-54-D06.
GenBankBT0064190.0BT006419.1 Arabidopsis thaliana At5g07680 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399249.10.0NAC domain-containing protein 79
SwissprotQ9FLR30.0NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A087G5K90.0A0A087G5K9_ARAAL; Uncharacterized protein
STRINGA0A087G5K90.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.10.0NAC domain containing protein 80
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]