PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK24890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NAC
Protein Properties Length: 371aa    MW: 42865.2 Da    PI: 6.6138
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK24890.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.52.3e-48241501128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppG+rFhPtdeelv++yLkkkv gk+  +++vi+ev+iyk++P+dL+  +k+k+++kewyfF   +kky +g+r nr+tk+g+Wkatgkd+ev+  ++
  KFK24890.1  24 LPPGYRFHPTDEELVSYYLKKKVLGKT--FFDVIAEVEIYKHKPSDLQeySKLKTRDKEWYFFGAMEKKYDSGNRMNRKTKEGFWKATGKDREVHG-GN 119
                 79************************9..5679**************9544889999**************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +l+g+ ktLvf+kg+apkg++t+Wv+heyrl
  KFK24890.1 120 QLIGMIKTLVFHKGSAPKGRRTNWVIHEYRL 150
                 *****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-5520174IPR003441NAC domain
PROSITE profilePS5100553.49924174IPR003441NAC domain
PfamPF023652.3E-2525150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGRDVMTGGG VLSALEEVPA KKSLPPGYRF HPTDEELVSY YLKKKVLGKT FFDVIAEVEI  60
YKHKPSDLQE YSKLKTRDKE WYFFGAMEKK YDSGNRMNRK TKEGFWKATG KDREVHGGNQ  120
LIGMIKTLVF HKGSAPKGRR TNWVIHEYRL VENNESPQDE EEQGEYVLCK LFCKNDIGPP  180
TGNRYAVFVE EEWEEWDEKS LIHIGNVRAM EDHVPIDVDD NVNNEIQQEN NQSERKCLID  240
LNELPKDIEM DDYESHKRKY VAEAPLPPKQ YKRRRSSRGN SNNSSQSTTT TVETTNVRSC  300
ASLAEKDTVT ALLELNVPEQ VGVHEDLMKA ETMIKFLQGE LNALREENME LRKNSSRNYN  360
IGQSSCRRKR T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-392317516166NO APICAL MERISTEM PROTEIN
1ut4_B5e-392317516166NO APICAL MERISTEM PROTEIN
1ut7_A5e-392317516166NO APICAL MERISTEM PROTEIN
1ut7_B5e-392317516166NO APICAL MERISTEM PROTEIN
3swm_A5e-392317519169NAC domain-containing protein 19
3swm_B5e-392317519169NAC domain-containing protein 19
3swm_C5e-392317519169NAC domain-containing protein 19
3swm_D5e-392317519169NAC domain-containing protein 19
3swp_A5e-392317519169NAC domain-containing protein 19
3swp_B5e-392317519169NAC domain-containing protein 19
3swp_C5e-392317519169NAC domain-containing protein 19
3swp_D5e-392317519169NAC domain-containing protein 19
3ulx_A5e-392017611170Stress-induced transcription factor NAC1
4dul_A5e-392317516166NAC domain-containing protein 19
4dul_B5e-392317516166NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256274KRKYVAEAPLPPKQYKRRR
2267273PKQYKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK24890.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302941.11e-95NAC domain-containing protein 74-like
SwissprotQ9SQY09e-91NAC52_ARATH; NAC domain containing protein 52
TrEMBLA0A087G4T80.0A0A087G4T8_ARAAL; Uncharacterized protein
STRINGA0A087G4T80.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.12e-79NAC domain containing protein 50
Publications ? help Back to Top
  1. Higgins JD,Ferdous M,Osman K,Franklin FC
    The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.
    Plant J., 2011. 65(3): p. 492-502
    [PMID:21265901]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]
  4. Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T
    sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation.
    Plant J., 2017. 90(3): p. 505-519
    [PMID:28207953]
  5. Elmayan T, et al.
    Arabidopsis mutants impaired in cosuppression.
    Plant Cell, 1998. 10(10): p. 1747-58
    [PMID:9761800]