PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK24518.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family LBD
Protein Properties Length: 268aa    MW: 29177.8 Da    PI: 8.233
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK24518.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.33e-3952150199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l++el ++++
  KFK24518.1  52 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQSLQSELTTVRT 150
                 7*********************************************************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.06751152IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-4052149IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MSREREGFGE YYEIVKKIKK DPTFETTTDH AVMGIRRHVA VPPGTTLNTV TPCAACKLLR  60
RRCAEECPFS PYFSPHEPHK FAAVHKVFGA SNVSKMLLEV GESQRGDAAN SLVYEANLRL  120
RDPIYGCMGA ISALQHHIQS LQSELTTVRT DILRHKYREA ATLTSLHNNN NNFNNNTTTS  180
VTDHADLAAA ILLPPPPPPP PPRPPRLLLS QPAPPPTPPA SLPSPSMVVS SSSSSNSSAT  240
NSMYNPSPSS AAGFSNSMSS DNNVHYYD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634930.11e-134PREDICTED: LOB domain-containing protein 13
SwissprotQ9AT611e-133LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A087G3R60.0A0A087G3R6_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.4__1005__AT2G30340.11e-131(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-119LOB domain-containing protein 13