PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK23965.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family CPP
Protein Properties Length: 389aa    MW: 43625.2 Da    PI: 5.8661
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK23965.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR461.1e-146099141
         TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                k++kgC+C++skClk+YC+Cfa+g++C + C C dC+N+++
  KFK23965.1 60 KKQKGCRCRQSKCLKLYCDCFASGEFCID-CDCADCHNNSD 99
                589**************************.********987 PP

2TCR49.96.5e-16145184241
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                 +++gC+Ck++kClkkYCeCf+a++ Cs++CkC +C+N +e
  KFK23965.1 145 SSRGCKCKRTKCLKKYCECFQANALCSDNCKCINCENVSE 184
                 579**********************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.8E-1660100IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.81661184IPR005172CRC domain
PfamPF036382.1E-116297IPR005172CRC domain
SMARTSM011143.3E-16144185IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.0E-12147181IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MIDMIGHIAS GAIAAEKNHT ELVFTKLELS SESPIKELAL FPPISQEPSE TTDQEGITWK  60
KQKGCRCRQS KCLKLYCDCF ASGEFCIDCD CADCHNNSDN CDIIEAALAN VLDRYPSTFS  120
GKSTNSVIDK QYEAAPVTKL GLRSSSRGCK CKRTKCLKKY CECFQANALC SDNCKCINCE  180
NVSERFQPSV FAWGLNKRKP ENNYNAQGII STNRDNVSFS SHHGADFMNN ASGFPSHSYL  240
QRKRYRELPE ATAEFSSXXX PPSSIPENSI LKDLHSPMSS SPKLPYRFDS SYDASFKISR  300
LLALNTPVIE LQTGLEDHNR ICINPHDDKQ DNISIELSSE SLSRNVQSCG RLIELIDTQY  360
NGVEDSKCKE TDIYMEQERA VLETFRDSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-176218411123Protein lin-54 homolog
5fd3_B5e-176218411123Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK23965.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015245.11e-160protein tesmin/TSO1-like CXC 8
SwissprotQ700D01e-123TCX8_ARATH; Protein tesmin/TSO1-like CXC 8
TrEMBLA0A087G2630.0A0A087G263_ARAAL; Uncharacterized protein
STRINGA0A087G2630.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148441520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16160.11e-119Tesmin/TSO1-like CXC domain-containing protein