PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK23649.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family GeBP
Protein Properties Length: 362aa    MW: 39721.2 Da    PI: 4.8015
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK23649.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573133.76.6e-42140232297
      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                 +fqrlwseeDei+lLqG+idf+++tgk p++d+++fy+++kksis++vsksq+++Kir+LKkK+++k k+   gk++sf+k+hd k+f+lsk iWg
  KFK23649.1 140 AFQRLWSEEDEIALLQGMIDFRDDTGKIPYEDTNGFYDYMKKSISVEVSKSQFMDKIRSLKKKYTGKGKN---GKDVSFTKPHDVKSFGLSKFIWG 232
                 69****************************************************************9999...**********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-32141232IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MTKKTLNPLD DPPTASSSDD DEVHTSAGEE EEEEEEEDSS SEEAPSAAVT VAVPGKTTVT  60
KQGSDSDSGS ETETDSDSET GSGKSMAVTV VATNPKKKEA TLALPAMKSG TKRPSEGTSR  120
DGGGNAKKKN KIGEDIKKPA FQRLWSEEDE IALLQGMIDF RDDTGKIPYE DTNGFYDYMK  180
KSISVEVSKS QFMDKIRSLK KKYTGKGKNG KDVSFTKPHD VKSFGLSKFI WGPDGMGIES  240
AKSNGISKKS KSKKLESVKQ DLFLGNGKMV EEVDDDDDDG KKVVVETGKT TDWFENSFLV  300
GSIASFGVDE YTVKQRWREA PVEDKKKIEE KMKALRAKEI EYVLEKTKFL NDFASMIAEA  360
SK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391972.11e-136hypothetical protein EUTSA_v10023503mg
TrEMBLA0A087G1970.0A0A087G197_ARAAL; Uncharacterized protein
STRINGBra021317.1-P1e-111(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-70DNA-binding storekeeper protein-related transcriptional regulator