PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK22551.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 313aa    MW: 34769.8 Da    PI: 10.3418
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK22551.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.8e-14106151247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE+ +++ + ++lG+g+W+ Ia++  ++Rt+ q+ s+ qky
       KFK22551.1 106 KPWTEEEHRIFLFGLNKLGKGDWRGIAKKYVTTRTPTQVASHAQKY 151
                      58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.365100156IPR017930Myb domain
SuperFamilySSF466891.1E-16101156IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-16103154IPR006447Myb domain, plants
SMARTSM007172.3E-10104154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-11104150IPR009057Homeodomain-like
PfamPF002491.2E-11106151IPR001005SANT/Myb domain
CDDcd001672.06E-9107152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MVKETAMTTK TCSHCGHNGH NSRTCLNGVN KGSVKLFGVN ISSVPIRPPE VTALRKSLSL  60
GHLDSLHANS NGNGDFLATV EDSGYHSDGL INSKKGKAAH AKKKGKPWTE EEHRIFLFGL  120
NKLGKGDWRG IAKKYVTTRT PTQVASHAQK YFVRLNAKDK RKRRASLFDI SLEDQEIHKI  180
SQVDVSTSSS KILPKQPITR SQEPVQGQTQ AAISNRFQNL SMEYMSLYQP VPPYYNFPSL  240
MFHPMYYANP EQVRFIHPSG IPVPRHIPIG MPQYQPNEAS NMTKKDGLEL GLGLPKPYPP  300
PQAATAHGVI HVK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK22551.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0122391e-60AB012239.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K11J9.
GenBankCP0026881e-60CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864744.11e-179probable transcription factor At5g61620
SwissprotQ9FKF91e-169M5162_ARATH; Probable transcription factor At5g61620
TrEMBLA0A087FY490.0A0A087FY49_ARAAL; Uncharacterized protein
STRINGA0A087FY500.0(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-154MYB_related family protein
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]