PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK22018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family GeBP
Protein Properties Length: 404aa    MW: 44216.5 Da    PI: 4.8834
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK22018.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573121.25.3e-38181273297
      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                 + qrlwseeDei+lLqG+++f++++gksp++d+++fyefvkk+i+f++sk+ql+eK+r+LKkK+ + +k+   gk +sf+k+hd k++ ls +iWg
  KFK22018.1 181 KKQRLWSEEDEIALLQGMLNFRKEKGKSPYEDTTEFYEFVKKCIQFEASKNQLMEKLRSLKKKYIGTRKN---GKVVSFTKPHDVKALTLSLSIWG 273
                 579****************************************************************999...**********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.3E-30183273IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MTKKPLNPLK DPPPATPSDD DEVESSSGEE EEEEEKEEGS SSEEEEGSSS EEDEPIAPSA  60
PIAPSAAAVT IVVPGKPTVS VTATEQGSES GSGSETETDS DSEPEEASKI PNSGSGKAIA  120
VTVASTNPKK KEGLPSATLA LPAVVSRTKR PGEGTSREGN AKRGKTVTSG EDEKKTGEGT  180
KKQRLWSEED EIALLQGMLN FRKEKGKSPY EDTTEFYEFV KKCIQFEASK NQLMEKLRSL  240
KKKYIGTRKN GKVVSFTKPH DVKALTLSLS IWGPQGICLE SVAKTNEKSQ RKTNGKSQRK  300
TEKLDSVKQD LFSPLPNGKS VQEDLEPQKT SDWFESSFLV QSIAQFGVYE ASVMQGWNLA  360
PVESKKMIEE RMRALRAKEL EYLMLKTQFL HDVTSMIAEG LKQM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391972.11e-121hypothetical protein EUTSA_v10023503mg
TrEMBLA0A087FWL60.0A0A087FWL6_ARAAL; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.13e-75DNA-binding storekeeper protein-related transcriptional regulator