PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK22006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB_related
Protein Properties Length: 103aa    MW: 12443.9 Da    PI: 7.9553
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK22006.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.6e-083674444
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +T++E++l+ + +++ G + W++Ia ++  gR +k++  +w
       KFK22006.1 36 MTEQEEDLIFRMHRLVGDR-WDLIAGRVA-GREAKEIERYW 74
                     7****************99.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.7E-63280IPR001005SANT/Myb domain
CDDcd001678.62E-63574No hitNo description
Gene3DG3DSA:1.10.10.602.8E-103675IPR009057Homeodomain-like
PfamPF002491.3E-73675IPR001005SANT/Myb domain
SuperFamilySSF466899.72E-73775IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1900033Biological Processnegative regulation of trichome patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MDNTNRLHDR RNRNHTKITL RESEEVSSIK WEFINMTEQE EDLIFRMHRL VGDRWDLIAG  60
RVAGREAKEI ERYWIMKNSD YFSNTRLQLH SLNTSPHSSI SHF
Functional Description ? help Back to Top
Source Description
UniProtMYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKFK22006.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1087777e-57DQ108777.1 Arabidopsis thaliana clone 22671 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295305.11e-43MYB-like transcription factor TCL2 isoform X1
SwissprotB3H4X85e-43TCL2_ARATH; MYB-like transcription factor TCL2
TrEMBLA0A087FWK41e-69A0A087FWK4_ARAAL; Uncharacterized protein
STRINGA0A087FWK42e-70(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30424.12e-45MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
    Front Plant Sci, 2015. 6: p. 955
    [PMID:26579186]